PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.9G173000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family GRAS
Protein Properties Length: 733aa    MW: 82972.6 Da    PI: 6.5102
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.9G173000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS345.39.8e-1063547241374
                GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                         l++lL++cAeavs ++++la+ +L+ ++++as +gd  qRla++++  L+ rla+++s+ly+ l +++ts      +l++++l   ++P+l
  Sevir.9G173000.1.p 354 LRTLLIHCAEAVSVNNHTLANDILSIIRQHASTSGDDSQRLAFCLADCLEVRLAGTGSQLYRNLMAKRTS---ALGTLKVFHLCIAICPFL 441
                         6789************************************************************999998...89999************* PP

                GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnv 180
                         +  +   N++I +  +g+ rvHiiDf+i  G+QWp+L+++La+R++gpp++RiTg+++p++g   +e+  + g+rLa++A+ +++pfe++ 
  Sevir.9G173000.1.p 442 RAPYYFSNKTITDVSKGKPRVHIIDFGICFGFQWPSLFEQLAKREGGPPKVRITGIEQPQPGfrPNESSMNAGHRLADYASMFNIPFEYQG 532
                         ***************************************************************9999999********************* PP

                GRAS 181 lvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsl 271
                          +++++e++++e+++++++++l+Vn++++l++l de+vs++s+r++vL++++ ++Pkv+++   + +++++ Fl+rf e +++ysalfd l
  Sevir.9G173000.1.p 533 -ISSKWETIKIEDFNIDKDDVLIVNCIYRLKNLGDETVSIDSARNRVLNTIRMMKPKVFIHGVVNGSYSTPFFLTRFKEVMYHYSALFDLL 622
                         .7***************************************************************************************** PP

                GRAS 272 eaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgW 362
                         ++++pr+ e+r+ +Er +    + nv+aceg+er+er e+++kW+ r ++aGF+++pl+ +++k  ++++r++++d y v+e++++l++gW
  Sevir.9G173000.1.p 623 DKTVPRDYEARMILERDIYLSVVLNVIACEGSERIERPESYKKWKLRNQKAGFEQLPLNPDTVKGTRAIVRQYHKD-YVVNEDDQWLLMGW 712
                         **************************************************************************77.************** PP

                GRAS 363 kdrpLvsvSaWr 374
                         k+r L+ +  W+
  Sevir.9G173000.1.p 713 KGRILYGIATWK 724
                         ***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098561.719328705IPR005202Transcription factor GRAS
PfamPF035143.4E-103354724IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 733 aa     Download sequence    Send to blast
MECNDRFNCN FEDFPSSMAN TPGCYASSQK FIDPTTEYND LDLLSHPASS INHYPPVATT  60
INNDGHVALS ASSSNKIYAP QFHGVSSNMT PDWYGTNVAE YSEDSWINSD ITLRYINKLL  120
MEEDSDDKFK PHHGESALRA MEEPLYRLIG QNYPANTQLL PLCSSDHMKT LDGSISNGQP  180
CSSFSVAISS GNNRYNDDLQ AFEAPWSLSA IVGETRQFTQ DTYTMELGLN VGGLSIVEKT  240
SRDNQSLQIN DRESRKHALF EVQCQKMNSC KEDFDLLEGR SNKQFATSFN EPTRNEIFDK  300
VLLCSDHELI DQGIVLQEAM ASKSTINSQT DQGRTSAQRK KKGKKQQRKE VVDLRTLLIH  360
CAEAVSVNNH TLANDILSII RQHASTSGDD SQRLAFCLAD CLEVRLAGTG SQLYRNLMAK  420
RTSALGTLKV FHLCIAICPF LRAPYYFSNK TITDVSKGKP RVHIIDFGIC FGFQWPSLFE  480
QLAKREGGPP KVRITGIEQP QPGFRPNESS MNAGHRLADY ASMFNIPFEY QGISSKWETI  540
KIEDFNIDKD DVLIVNCIYR LKNLGDETVS IDSARNRVLN TIRMMKPKVF IHGVVNGSYS  600
TPFFLTRFKE VMYHYSALFD LLDKTVPRDY EARMILERDI YLSVVLNVIA CEGSERIERP  660
ESYKKWKLRN QKAGFEQLPL NPDTVKGTRA IVRQYHKDYV VNEDDQWLLM GWKGRILYGI  720
ATWKTSESYN GD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A8e-443587248375GRAS family transcription factor containing p
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1337344QRKKKGKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008665057.10.0PREDICTED: scarecrow-like protein 34 isoform X1
RefseqXP_008665058.10.0PREDICTED: scarecrow-like protein 34 isoform X2
TrEMBLK4ALU30.0K4ALU3_SETIT; Uncharacterized protein
STRINGSi039877m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP117882640
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-150GRAS family protein